Global Trade leader ecrobot

Product Name:Sermorelin acetateMolecular Formula: C149H246N44O42SCAS NO.: 86168-78-7Purity:Above 98%Packing:2mg/vial;10vials/boxAppearance: White lyophilized powderMethod of Analysis: HPLCStorage: Lyophilized peptides although stable at room temperature for 3 months, should be stored desiccated belo…

Product name: SermorelinPackage:100iu/10vails/1 kit If you have any intersted,pls contact:mike@health222chem.com or Skype:mike_health205 Our advantage:1.Place of Origin China with Super quality by reasonable price.2.Fast delivery by safe express way to all the country.3.Has a number of highl…

Pharmaceutical Bodybuilding Peptides Sermorelin 2mg/Vial 100% Safe Delivery Basic info: Product Name: Sermorelin CAS: 86168-78-7 MF: C149H246N44O42 SMW: 3357.88 EINECS:   Product Categories: Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell …

Sermorelin Acetate Peptide Hormones whatsapp:+8617707569722 whatsapp:+8617707569722 web: www.roidraw.com email: lucy@wumeitech.com Body Builder Sermorelin Acetate Peptide Hormones Bodybuilding 99% HPLC Production Capacity: 1000vial/Week Payment Terms:T/T, Western Union, Money Gra…

Synonyms: GRF 1-29, Sermorelina, Sermoreline, SermorelinumCAS NO.: 86168-78-7Molecular Formula: C149H246N44O42SMolar Mass: 3357.96PubChem: CID 16129620Molecular weight: 3357.88Peptide purity: > 98.0%Appearance: White lyophilized powderRelated substance: Total Impurities (%) &l…

     Sermorelin 2mg/vial Growth Hormone Peptides Lyophilized Powder   1. We are Chinese factory supplier . our product have 300 kinds more,asically divided into 3 categories :Steroids powder / liquids an…

Sermorelin Anabolic Androgenic Steroids Peptide CAS 86168-78-7 skype: Trina1025 QQ:2355880554 Tel：+8602750756161lrj08@ycphar.com dantutti@yuanchengtech.com Sermorelin 2mg (GRF 1-29) PeptideSequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu…

Name Sermorelin Acetate Molecular Formula C149H246N44O42S.C2H4O2 Molecular Weight 3417.97 CAS Registry Number 114466-38-5 Our advantages 1.Our company is a professional production leading factory in China in pharmaceutical area of 20years,our products have exported to Germany, Spain,…

Name Sermorelin Acetate Molecular Formula C149H246N44O42S.C2H4O2 Molecular Weight 3417.97 CAS Registry Number 114466-38-5 Our advantages 1.Our company is a professional production leading factory in China in pharmaceutical area of 20years,our products have exported to Germany, Spain,…

Name Sermorelin Molecular Formula C149H246N44O42S Molecular Weight 3357.88 CAS Registry Number 86168-78-7 Our advantages 1.Our company is a professional production leading factory in China in pharmaceutical area of 20years,our products have exported to Germany, Spain, UK, USA, Aust…

Rleasing Sermorelin Peptide powder Hormone Ghrh for Bodybuilding 2mg Product Decription Quick details: - - - - Product Name | ghrh | Chemical Name | Sermorelin Acetate,GRF 1-29, | CAS Number | 86168-78-7 | Molecular Formula | C149H246N44O42S | Molecular We…

CAS NO.114466-38-5 GRF 1-29 peptide Sermorelin Acetate 2mg 5mg for bodybuilding - - - - Product Name: | Sermorelin | Synonyms: | SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LE…

Rleasing Sermorelin Peptide powder Hormone Ghrh for Bodybuilding 2mg Product Decription Quick details: - - - - Product Name | ghrh | Chemical Name | Sermorelin Acetate,GRF 1-29, | CAS Number | 86168-78-7 | Molecular Formula | C149H246N44O42S | Molecular We…

99% Purity Muscle Building Steroids Peptide Powder Sermorelin For Alduts   1 . Description Alias: GRF 1-29 NH2, Sermorelin Acetate HydrateCAS: 86168-78-7Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Ar…

About us: Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment,&nbs…

About us: Professional supply High quality real HGH, promise safe and low pricea accept OEM. Fast and safe shipment,&nbs…

Product Name: Anabiolic Steroid Peptide Sermorelin /skype:bodybuilding848   Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Cas No.: 86168-78-7 Molecular Formula: C149H246N44O42S Molecula…

Sermorelin, 2mg/vial Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-L…

Sermorelin Acetate Molecular Formula:C149H246N44O42 Molecular Weight:3358.03 CAS No.:86168-78-7 SPECIFICATIONS: 1.Appearance :White powder 2.Specific Optical Rotation(c=0.5,1%HAc) :-80.0~-90.0° 3.Water Content(Karl Fischer) :≤6.0% 4.Acetate Content(by HPLC) :≤15.0% 5.Amino Acid Com…

Sermorelin/GRF(1-29) Molecular Formula:C149H246N44O42 Molecular Weight:3358.03 CAS No.:86168-78-7 Sermorelin/GRF(1-29)(injection):2mg/vial. Sequence:Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 SPECIFICATIONS: 1…

Sermorelin graceyu52@hotmail.com Peptide Hormones GHRH Releasing Hormone Sermorelin Wuhan Magic Biotechnology Co., Ltd.skype:mary whmoliwechat/QQ.920821374Email:graceyu52@hotmail.com.whatsapp:+8613349906569  Quick Detail: grow hormone releasing hormone  S…

Sermorelin Peptides Triptorelin Ipamorelin Hexarelin Basic Info.Model NO.:PeptidesSpecification:2mg/VialExport Markets:Global Additional Info.Trademark:YCPacking:Discreet PackageStandard:250mg/ml  Origin:Hubei HS Code:1502001000 Production Capacity:500kg/Month &…

Welcome to Charmbio Co.,Ltd. Charm Bio for more products: Peptides, custom peptide synthesis services, other biological proteins melanotan-1,melanotan-2,GHRP-2,GHRP-6,CJC1295,DAC-CJC1295,MGF,PEG-MGF,HGH,IGF,Sermorelin,Hexarelin,PT141,Argireline 1mg\2mg\5mg\10mg\20mg\30mg\50mg\100mg\1000mg